PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G092000.1
Common NamePHAVU_007G092000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 219aa    MW: 23662.3 Da    PI: 6.484
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G092000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.8e-43651641100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+
  Phvul.007G092000.1  65 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQ 155
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Phvul.007G092000.1 156 AQLAKAQAE 164
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.18164165IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-4365162IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MDYKLNTTTP SPPIPIPIHV PSMLSNSPPS SSSSPPSHSP TPFPSPSPSP SAAPPSPPPP  60
VVVSPCAACK ILRRRCVEKC VLAPYFPPTD PLKFTIAHRV FGASNIIKFL QELPESQRAD  120
AVSSMVYEAN ARIRDPVYGC AGAICQLQKQ VSELQAQLAK AQAELVNMQC QQANLVALIC  180
MEMSQSQEQH VVQPQPLVDM SCFIEDNTFG TAWEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0991130.0BT099113.1 Soybean clone JCVI-FLGm-13B15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143674.11e-157hypothetical protein PHAVU_007G092000g
SwissprotQ9LQR02e-77LBD1_ARATH; LOB domain-containing protein 1
TrEMBLV7BFQ11e-157V7BFQ1_PHAVU; Uncharacterized protein
STRINGGLYMA20G31780.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-61LOB domain-containing protein 1